missing translation for 'onlineSavingsMsg'
Learn More

NDUFA1 Antibody [DyLight 650], Novus Biologicals Biologicals™

Product Code. 30515387 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30515387 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30515387 Supplier Novus Biologicals Supplier No. NBP338523C

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

NDUFA1 Polyclonal antibody specifically detects NDUFA1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NDUFA1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 650
Formulation 50mM Sodium Borate
Gene Alias CI-MWFEcomplex I MWFE subunit, Complex I-MWFE, MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa, NADH oxidoreductase subunit MWFE, NADH:ubiquinone oxidoreductase (complex 1), NADH-ubiquinone oxidoreductase MWFE subunit, type I dehydrogenase, ZNF183
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NDUFA1 (NP_004532.1).,, Sequence:, MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4694
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.