missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00
Specifications
| Antigen | NDUFA3 |
|---|---|
| Dilution | Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NDUFA3 Polyclonal specifically detects NDUFA3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NDUFA3 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4696 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| B9, CI-B9, complex I B9 subunit, Complex I-B9, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 (9kD, B9), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3, NADH-ubiquinone oxidoreductase B9 subunit | |
| NDUFA3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title