missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37940-100ul
This item is not returnable.
View return policy
Description
NDUFA4 Polyclonal antibody specifically detects NDUFA4 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| NDUFA4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| CI-9k, CI-MLRQ, Complex I 9kDa subunit, Complex I-MLRQ, FLJ27440, MGC104422, MGC126843, MGC126845, MLRQ, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4, NADH-ubiquinone oxidoreductase MLRQ subunit | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1).,, Sequence:, MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF | |
| 100 μL | |
| Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| 4697 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction