missing translation for 'onlineSavingsMsg'
Learn More

NDUFAB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-35453-20ul

View more versions of this product

Product Code. 30229939

€ 190.00 / 20µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

NDUFAB1 Polyclonal antibody specifically detects NDUFAB1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

Antigen	NDUFAB1
Classification	Polyclonal
Dilution	Western Blot 1:500 - 1:1000, ELISA
Gene Alias	ACPMGC65095, acyl carrier protein, mitochondrial, CI-SDAP, complex I SDAP subunit, FASN2A, mitochondrial acyl carrier protein, NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (8kD, SDAP), NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa, NADH:ubiquinone oxidoreductase SDAP subunit, NADH-ubiquinone oxidoreductase 9.6 kDa subunit, SDAP
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-156 of human NDUFAB1 (NP_004994.1).,, Sequence:, PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Quantity	20 μL
Research Discipline	Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)	4706
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

NDUFAB1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions