missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFS6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38065-20ul
This item is not returnable.
View return policy
Description
NDUFS6 Polyclonal antibody specifically detects NDUFS6 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| NDUFS6 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| CI13KDA, Complex I-13kD-A, mitochondrial respiratory chain, 13-kD subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 6 (13kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial, NADH:ubiquinone oxidoreductase NDUFS6 subunit, NADH-ubiquinone oxidoreductase 13 kDa-A subunit | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1).,, Sequence:, GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH | |
| 20 μL | |
| metabolism | |
| 4726 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction