missing translation for 'onlineSavingsMsg'
Learn More

NDUFS6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-38065-100ul

View more versions of this product

Product Code. 30232157

€ 550.00 / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

NDUFS6 Polyclonal antibody specifically detects NDUFS6 in Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

Antigen	NDUFS6
Classification	Polyclonal
Dilution	Western Blot 1:500 - 1:2000, ELISA
Gene Alias	CI13KDA, Complex I-13kD-A, mitochondrial respiratory chain, 13-kD subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 6 (13kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial, NADH:ubiquinone oxidoreductase NDUFS6 subunit, NADH-ubiquinone oxidoreductase 13 kDa-A subunit
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1).,, Sequence:, GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Quantity	100 μL
Research Discipline	metabolism
Gene ID (Entrez)	4726
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Mouse, Rat
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

NDUFS6 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions