missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Necdin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57334-25ul
This item is not returnable.
View return policy
Description
Necdin Polyclonal specifically detects Necdin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| Necdin | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| HsT16328, necdin, necdin (mouse) homolog, necdin homolog (mouse), PWCR | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| NDN | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLI | |
| 25 μL | |
| Apoptosis, Cancer, Tumor Suppressors | |
| 4692 | |
| Human | |
| Purified |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?
For Research Use Only