missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEI3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | NEI3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18249353
|
Novus Biologicals
NBP2-56282 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18613628
|
Novus Biologicals
NBP2-56282-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NEI3 Polyclonal specifically detects NEI3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NEI3 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 55247 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| DNA glycosylase FPG2, DNA glycosylase hFPG2, DNA glycosylase/AP lyase Neil3, EC 3.2.2.-, EC 4.2.99.18, endonuclease 8-like 3, Endonuclease VIII-like 3, FGP2, FLJ10858, FPG2, hFPG2, hNEI3, nei endonuclease VIII-like 3 (E. coli), NEI3, Nei-like protein 3 | |
| NEIL3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title