missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEK5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48737
This item is not returnable.
View return policy
Description
NEK5 Polyclonal antibody specifically detects NEK5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| NEK5 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| never in mitosis A-related kinase 5, NIMA (never in mitosis gene a)-related kinase 5, nimA-related protein kinase 5, serine/threonine-protein kinase Nek5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ | |
| 0.1 mL | |
| Protein Kinase | |
| 341676 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction