missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NEK7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | NEK7 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226657
|
Novus Biologicals
NBP3-37907-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229552
|
Novus Biologicals
NBP3-37907-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NEK7 Polyclonal antibody specifically detects NEK7 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| NEK7 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.3), 50% glycerol | |
| 140609 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 2.7.11.1, Never in mitosis A-related kinase 7, NIMA (never in mitosis gene a)-related kinase 7, NimA-related protein kinase 7, serine/threonine-protein kinase Nek7 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 257-301 of human NEK7 (NP_598001.1).,, Sequence:, PLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTAS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title