missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuropilin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 369.00 - € 593.00
Specifications
| Antigen | Neuropilin-2 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18433711
|
Novus Biologicals
NBP1-86866-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18726233
|
Novus Biologicals
NBP1-86866 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Neuropilin-2 Polyclonal specifically detects Neuropilin-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Neuropilin-2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O60462 | |
| 8828 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Cancer, Hypoxia | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MGC126574, neuropilin 2, neuropilin-2, neuropilin-2a(22), neuropilin-2b(0), NP2, NPN 2, NPN2, PRO2714, receptor for VEGF165 and semaphorins class3, Vascular endothelial cell growth factor 165 receptor 2, vascular endothelial growth factor-165 receptor 2, VEGF1265R2, VEGF165R2neuropilin-2a(17) | |
| NRP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title