missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neurotrypsin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38231
This item is not returnable.
View return policy
Description
Neurotrypsin Polyclonal specifically detects Neurotrypsin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Neurotrypsin | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P56730 | |
| PRSS12 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK | |
| 0.1 mL | |
| Vision | |
| 8492 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| brain-specific serine protease 3, BSSP3, BSSP-3, EC 3.4.21, leydin, MGC12722, Motopsin, MRT1EC 3.4.21.-, neurotrypsin, protease, serine, 12 (neurotrypsin, motopsin), Serine protease 12 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction