missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NF-M Antibody (CL2688), Novus Biologicals™
Mouse Monoclonal Antibody
€ 369.00 - € 500.00
Specifications
| Antigen | NF-M |
|---|---|
| Clone | CL2688 |
| Dilution | Western Blot 1 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18695645
|
Novus Biologicals
NBP2-46618-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615855
|
Novus Biologicals
NBP2-46618 |
0.1 mL |
€ 500.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NF-M Monoclonal antibody specifically detects NF-M in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| NF-M | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| P07197 | |
| 4741 | |
| IgG1 | |
| Protein A purified |
| CL2688 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Autophagy, Cell Biology, Cellular Markers, Neurodegeneration, Neuronal Cell Markers, Neuroscience | |
| PBS (pH 7.2), 40% Glycerol | |
| NEF3neurofilament medium polypeptide, Neurofilament 3, neurofilament, medium polypeptide, neurofilament, medium polypeptide 150kDa, neurofilament-3 (150 kD medium), NF-M160 kDa neurofilament protein, NFMNeurofilament triplet M protein | |
| Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title