missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NFIX Polyclonal antibody specifically detects NFIX in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | NFIX |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | DyLight 350 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CTF, NF1ACCAAT-box-binding transcription factor, NF1-X, NF-I/X, NFI-X, nuclear factor 1 X-type, Nuclear factor 1/X, Nuclear factor I/X, nuclear factor I/X (CCAAT-binding transcription factor), TGGCA-binding protein |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NFIX (NP_002492.2).,, Sequence:, AYFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVT |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?