missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NGL-1/LRRC4C Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 486.00 - € 741.00
Specifications
| Antigen | NGL-1/LRRC4C |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18391517
|
Novus Biologicals
NBP3-17662-25UL |
25 μg |
€ 486.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18330235
|
Novus Biologicals
NBP3-17662-100UL |
100 μg |
€ 741.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NGL-1/LRRC4C Polyclonal antibody specifically detects NGL-1/LRRC4C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| NGL-1/LRRC4C | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| KIAA1580NGL-1NGL1Netrin-G1 ligand, leucine rich repeat containing 4C, leucine-rich repeat-containing protein 4C | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 57689 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title