missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NGL-3/LRRC4B/LRCH4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | NGL-3/LRRC4B/LRCH4B |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18470952
|
Novus Biologicals
NBP2-31736-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18144625
|
Novus Biologicals
NBP2-31736 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NGL-3/LRRC4B/LRCH4B Polyclonal specifically detects NGL-3/LRRC4B/LRCH4B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NGL-3/LRRC4B/LRCH4B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp761A179, HSM, Leucine Rich Repeat Containing 4B, Leucine-Rich Repeat-Containing Protein 4B, Leucine-Rich Repeats And Immunoglobulin-Like Domains 4, LRIG4, LRRC4B, Netrin-G3 Ligand, NGL-3 | |
| LRRC4B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9NT99 | |
| 94030 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title