missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NGL-3/LRRC4B/LRCH4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | NGL-3/LRRC4B/LRCH4B |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18470952
|
Novus Biologicals
NBP2-31736-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18144625
|
Novus Biologicals
NBP2-31736 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NGL-3/LRRC4B/LRCH4B Polyclonal specifically detects NGL-3/LRRC4B/LRCH4B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NGL-3/LRRC4B/LRCH4B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp761A179, HSM, Leucine Rich Repeat Containing 4B, Leucine-Rich Repeat-Containing Protein 4B, Leucine-Rich Repeats And Immunoglobulin-Like Domains 4, LRIG4, LRRC4B, Netrin-G3 Ligand, NGL-3 | |
| LRRC4B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9NT99 | |
| 94030 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto