missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NGX6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-30610
This item is not returnable.
View return policy
Description
NGX6 Polyclonal specifically detects NGX6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| NGX6 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| A6NDV4 | |
| TMEM8B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLD | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 51754 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C9orf127, chromosome 9 open reading frame 127, NAG-5, nasopharyngeal carcinoma expressed 6, nasopharyngeal carcinoma related protein, Nasopharyngeal carcinoma-associated gene 6 protein, NGX6MGC120460, Protein NAG-5, Protein NGX6, RP11-112J3.10, transmembrane protein 8B | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction