missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nicastrin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 560.70
Specifications
| Antigen | Nicastrin |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18216715
|
Novus Biologicals
NBP2-57365 |
100 μL |
€ 593.00 € 560.70 / 100µL Save € 32.30 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624087
|
Novus Biologicals
NBP2-57365-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Nicastrin Polyclonal specifically detects Nicastrin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Nicastrin | |
| Polyclonal | |
| Rabbit | |
| Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 23385 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| anterior pharynx-defective 2, ATAG1874, KIAA0253APH2, nicastrin | |
| NCSTN | |
| IgG | |
| Affinity Purified |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts