missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NIF3L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | NIF3L1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18647195
|
Novus Biologicals
NBP2-38923-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18126518
|
Novus Biologicals
NBP2-38923 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NIF3L1 Polyclonal specifically detects NIF3L1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NIF3L1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ALS2CR1, candidate 1, MDS015, NIF3 NGG1 interacting factor 3-like 1 (S. pombe), NIF3-like protein 1, S.pombe homolog)-like 1 | |
| NIF3L1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9GZT8 | |
| 60491 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title