missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NIR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-34132-25ul
This item is not returnable.
View return policy
Description
NIR2 Polyclonal specifically detects NIR2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| NIR2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| O00562 | |
| PITPNM1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP | |
| 25 μL | |
| Vision | |
| 9600 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DRES9NIR-2, Drosophila retinal degeneration B homolog, FLJ44997, membrane-associated phosphatidylinositol transfer protein 1, NIR2PITPNM, phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2, PITPnm 1, Rd9, RDGB, RDGB1, RDGBA, RDGBA1, retinal degeneration B alpha 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction