missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDR45L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 493.00
Specifications
| Antigen | WDR45L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
WDR45L Polyclonal specifically detects WDR45L in Human, Rat samples. It is validated for Western Blot.Specifications
| WDR45L | |
| Polyclonal | |
| Rabbit | |
| NP_001034676 | |
| 56270 | |
| Synthetic peptide towards Wdr45l. Peptide sequence YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| WDR45-like, WDR45-like protein, WIPI3 | |
| WDR45L | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title