missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NLRP5 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 470.00
Specifications
| Antigen | NLRP5 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18665571
|
Novus Biologicals
NBP2-93564-0.02ml |
0.02 mL |
€ 204.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661371
|
Novus Biologicals
NBP2-93564-0.1ml |
0.1 mL |
€ 470.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NLRP5 Polyclonal antibody specifically detects NLRP5 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| NLRP5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Signaling Pathway | |
| PBS (pH 7.3), 50% glycerol | |
| 126206 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CLR19.8, MATERMater protein homolog, NACHT, leucine rich repeat and PYD containing 5, NACHT, LRR and PYD domains-containing protein 5, NALP5maternal antigen that embryos require, NLR family, pyrin domain containing 5, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 5, PAN11, PYPAF8 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 157-256 of human NLRP5 (NP_703148.4). TMTDQGPSKEKVPGISQAVQQDSATAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENT | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title