missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NLRP7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | NLRP7 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18491082
|
Novus Biologicals
NBP2-13661-25ul |
25ul |
€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18175690
|
Novus Biologicals
NBP2-13661 |
0.1 mL |
€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NLRP7 Polyclonal specifically detects NLRP7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NLRP7 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 199713 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: LNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CLR19.4, MGC126471, NACHT, leucine rich repeat and PYD containing 7, NACHT, LRR and PYD containing protein 7, NACHT, LRR and PYD domains-containing protein 7, NALP7MGC126470, NLR family, pyrin domain containing 7, NOD12HYDM, Nucleotide-binding oligomerization domain protein 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 7, PAN7, PYPAF3FLJ94610, PYRIN-containing APAF1-like protein 3 | |
| NLRP7 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title