missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NMNAT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | NMNAT3 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18457221
|
Novus Biologicals
NBP2-31675-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18173305
|
Novus Biologicals
NBP2-31675 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NMNAT3 Polyclonal specifically detects NMNAT3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NMNAT3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.7.7.1, EC 2.7.7.18, NaMN adenylyltransferase 3, nicotinamide mononucleotide adenylyltransferase 3, nicotinamide nucleotide adenylyltransferase 3, Nicotinate-nucleotide adenylyltransferase 3, PNAT-3, PNAT3NMN adenylyltransferase 3, Pyridine nucleotide adenylyltransferase 3 | |
| NMNAT3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96T66 | |
| 349565 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title