missing translation for 'onlineSavingsMsg'
Learn More
Learn More
nNOS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 470.00
Specifications
| Antigen | nNOS |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18236891
|
Novus Biologicals
NBP2-58114 |
100 μL |
€ 470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18688038
|
Novus Biologicals
NBP2-58114-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
nNOS Polyclonal specifically detects nNOS in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| nNOS | |
| Polyclonal | |
| Rabbit | |
| Asthma, Cancer, HIF Target Genes, Hypoxia, Immunology, Neuroscience, Neurotransmission | |
| bNOS, brain, Constitutive NOS, EC 1.14.13.39, IHPS1, Neuronal NOS, nitric oxide synthase 1 (neuronal), N-NOS, nNOSNOS type I, NOS, Peptidyl-cysteine S-nitrosylase NOS1 | |
| NOS1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 4842 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title