missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nociceptin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59307
This item is not returnable.
View return policy
Description
Nociceptin Polyclonal specifically detects Nociceptin in Human, Rat samples. It is validated for Western Blot.
Specifications
| Nociceptin | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| nociceptin, nocistatin, OFQ, P, PPNOC, prepronociceptin, propronociceptin | |
| Rabbit | |
| 20 kDa | |
| 100 μL | |
| Neuroscience, Signal Transduction | |
| 5368 | |
| Human, Rat, Bovine, Canine, Equine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q13519 | |
| PNOC | |
| Synthetic peptides corresponding to PNOC(prepronociceptin) The peptide sequence was selected from the middle region of PNOC (NP_006219). Peptide sequence EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction