missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-92192-25ul
This item is not returnable.
View return policy
Description
NOL1 Polyclonal specifically detects NOL1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.
Specifications
| NOL1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P46087 | |
| NOP2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human NOL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.1.1, EC 2.1.1.-, MGC149287, MGC149288, NOL1/NOP2/Sun domain family, member 1, NOL1MGC117384, NOP120, NOP2 nucleolar protein homolog (yeast), NOP2/Sun domain family, member 1, NSUN1, Nucleolar protein 1, nucleolar protein 1 (120kD), nucleolar protein 1, 120kDa, Nucleolar protein 2 homolog, nucleolar protein 2 homolog (yeast), p120, Proliferating-cell nucleolar antigen p120, Proliferation-associated nucleolar protein p120, putative ribosomal RNA methyltransferase NOP2 | |
| Rabbit | |
| 89 kDa | |
| 25 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 4839 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction