missing translation for 'onlineSavingsMsg'
Learn More
Learn More
non-muscle heavy chain 10 Myosin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 589.00
Specifications
| Antigen | non-muscle heavy chain 10 Myosin |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18745003
|
Novus Biologicals
NBP2-38566 |
0.1 mL |
€ 589.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18666495
|
Novus Biologicals
NBP2-38566-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
non-muscle heavy chain 10 Myosin Polyclonal specifically detects non-muscle heavy chain 10 Myosin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| non-muscle heavy chain 10 Myosin | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P35580 | |
| 4628 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Cellular myosin heavy chain, type B, cellular myosin heavy chain, type B type B, heavy polypeptide 10, non-muscle, MGC134913, MGC134914, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin-10, near to the ATP binding region, NMMHC II-b, NMMHCB, NMMHC-B, NMMHC-IIB, Non-muscle myosin heavy chain B, nonmuscle myosin heavy chain IIB, Non-muscle myosin heavy chain IIb, nonmuscle myosin heavy chain-B, nonmuscle myosin II heavy chain-B | |
| MYH10 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title