missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NOP14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13665-25ul
This item is not returnable.
View return policy
Description
NOP14 Polyclonal specifically detects NOP14 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| NOP14 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
| C4orf9, chromosome 4 open reading frame 9, NOL14nucleolar protein 14 homolog (yeast), NOP14 homolog, NOP14 nucleolar protein homolog (yeast), Nucleolar complex protein 14, nucleolar protein 14, nucleolar protein 14 homolog, probable nucleolar complex protein 14, RES425, RES4-25 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 8602 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| NOP14 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: REKPKSRKELIEELIAKSKQEKRERQAQREDALELTEKLDQDWKEIQTLLSHKTPKSENRDKKEKPKPDAYDMMVRELGFEMKAQPSNRMKT | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction