missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Recombinant Human PPIL1 His Protein

Product Code. 18201492 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
This item is not returnable. View return policy

Product Code. 18201492

Brand: Novus Biologicals™ NBC118379

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Specific activity is > 700 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1nmole of suc-AAPF-pNA per minute at 37C in Tris-HCl pH 8.0 using chymotrypsin.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number NP_057143
For Use With (Application) Bioactivity, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 8.0), 20% glycerol
Gene ID (Entrez) 51645
Molecular Weight (g/mol) 19.3kDa
Name PPIL1 Protein
Purification Method Protein
Quantity 0.1 mg
Source E. Coli
Immunogen 1-166aa, MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSGLEHHHHHH
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.