missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NRAGE/MAGED1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | NRAGE/MAGED1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
NRAGE/MAGED1 Polyclonal specifically detects NRAGE/MAGED1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| NRAGE/MAGED1 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| DLXIN-1, MAGE tumor antigen CCF, melanoma antigen family D, 1, melanoma-associated antigen D1, Neurotrophin receptor-interacting MAGE homolog, NRAGE, NRAGE MAGE-D1 antigen | |
| MAGED1 | |
| IgG | |
| 86 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_008917 | |
| 9500 | |
| The immunogen for this antibody is MAGED1 - C-terminal region. Peptide sequence ACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKLGLLLV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title