missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NTB-A/SLAMF6/CD352 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49002
This item is not returnable.
View return policy
Description
NTB-A/SLAMF6/CD352 Polyclonal antibody specifically detects NTB-A/SLAMF6/CD352 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| NTB-A/SLAMF6/CD352 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Activating NK receptor, CD352 antigen, KALIFLJ50657, Ly108, NK-T-B-antigen, NTBA receptor, NTB-AMGC104953, NTBAT- and B-cell antigen, SF2000, SLAM family member 6 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKT | |
| 0.1 mL | |
| Immunology | |
| 114836 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto