missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUDT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | NUDT2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18294214
|
Novus Biologicals
NBP2-57066 |
100 μL |
€ 624.00 € 590.10 / 100µL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18681168
|
Novus Biologicals
NBP2-57066-25ul |
25 μL |
€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NUDT2 Polyclonal specifically detects NUDT2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| NUDT2 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Apoptosis | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 318 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Ap4A hydrolase, Ap4A hydrolase 1, Ap4Aase, APAH1Diadenosine 5'-5'''-P1, bis(5'-nucleosyl)-tetraphosphatase (asymmetrical), bis(5'-nucleosyl)-tetraphosphatase [asymmetrical], diadenosine 5'-5''-P1, Diadenosine tetraphosphatase, EC 3.6.1.17, MGC10404, Nucleoside diphosphate-linked moiety X motif 2, nudix (nucleoside diphosphate linked moiety X)-type motif 2, Nudix motif 2, P4-tetraphosphate asymmetrical hydrolase, P4-tetraphosphate pyrophosphohydrolase | |
| NUDT2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title