missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUDT21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57491
This item is not returnable.
View return policy
Description
NUDT21 Polyclonal specifically detects NUDT21 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| NUDT21 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| CFIm25, CFIM25CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, Cleavage and polyadenylation specificity factor 25 kDa subunit, cleavage and polyadenylation specificity factor subunit 5, CPSF25, CPSF5DKFZp686H1588, Nucleoside diphosphate-linked moiety X motif 21, nudix (nucleoside diphosphate linked moiety X)-type motif 21, Nudix motif 21, pre-mRNA cleavage factor Im (25kD), Pre-mRNA cleavage factor Im 25 kDa subunit, pre-mRNA cleavage factor Im, 25kD subunit | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| NUDT21 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPG | |
| 100 μL | |
| Proteases & Other Enzymes | |
| 11051 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction