missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUDT4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 540.75
Specifications
| Antigen | NUDT4 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18487860
|
Novus Biologicals
NBP1-84250-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18213676
|
Novus Biologicals
NBP1-84250 |
0.1 mL |
€ 572.00 € 540.75 / 0.10mL Save € 31.25 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NUDT4 Polyclonal specifically detects NUDT4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NUDT4 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| Diadenosine 5'-5'''-P1, diphosphoinositol polyphosphate phosphohydrolase 2, diphosphoinositol polyphosphate phosphohydrolase type 2, DIPP-2, DIPP2alpha, DIPP2beta, DIPP2HDCMB47P, EC 3.6.1.-, EC 3.6.1.52, KIAA0487DKFZp686I1281, Nucleoside diphosphate-linked moiety X motif 4, nudix (nucleoside diphosphate linked moiety X)-type motif 4, Nudix motif 4, P6-hexaphosphate hydrolase 2 | |
| NUDT4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 11163 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title