missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Nuf2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 450.00 - € 708.00
Specifications
| Antigen | Nuf2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18663994
|
Novus Biologicals
NBP3-21404-100ul |
100 μg |
€ 708.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607654
|
Novus Biologicals
NBP3-21404-25ul |
25 μg |
€ 450.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Nuf2 Polyclonal antibody specifically detects Nuf2 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| Nuf2 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, 40% glycerol | |
| 83540 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| cancer/testis antigen 106, CDCA1hsNuf2, cell division cycle associated 1, Cell division cycle-associated protein 1, CT106, hNuf2, kinetochore protein Nuf2, NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae), NUF2RhNuf2R | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YGDSVDCLPSCQLEVQLYQKKIQDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title