missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Nup153 Polyclonal antibody specifically detects Nup153 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Nup153 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | CoraFluor 1 |
| Formulation | PBS |
| Gene Alias | CG4453, Dmel\CG4453, dmNup153, dNup153, HNUP153, N153, nuclear pore complex protein hnup153,153 kDa nucleoporin, nuclear pore complex protein Nup153, nucleoporin 153kD, nucleoporin 153kDa, Nucleoporin Nup153, Nup 153, nup153, Nup153 Nucleoporin 153 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nup153 (NP_005115.2).,, Sequence:, FQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMR |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?