missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NUPL1 Antibody, Novus Biologicals™

NUPL1 Antibody, Novus Biologicals™

Artikelnummer. p-200046427 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Quantity:
0.1 mL
25ul
Pakningsstørrelse:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18444822 25ul 25µL
18093539 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18444822 Leverandør Novus Biologicals Leverandørnr. NBP21368425ul

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

NUPL1 Polyclonal specifically detects NUPL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen NUPL1
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias KIAA0410PRO2463, nucleoporin like 1, nucleoporin p58/p45, Nucleoporin-like protein 1
Gene Symbols NUP58
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: RNTLNIDKLKIETALELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKI
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9818
Test Specificity Specificity of human NUPL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.