missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NUT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00 - € 549.00
Specifications
| Antigen | NUT |
|---|---|
| Concentration | 0.4mg/mL |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18417390
|
Novus Biologicals
NBP1-84176-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18758383
|
Novus Biologicals
NBP1-84176 |
0.1 mL |
€ 549.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
NUT Polyclonal specifically detects NUT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| NUT | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C15orf55, chromosome 15 open reading frame 55, DKFZp434O192, FAM22H, MGC138683, MGC138684, Nuclear protein in testis, NUT, protein NUT | |
| NUTM1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| 0.4mg/mL | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 256646 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel