missing translation for 'onlineSavingsMsg'
Learn More
Learn More
O-GlcNAc Transferase p110 subunit Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 500.00
Specifications
| Antigen | O-GlcNAc Transferase p110 subunit |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
O-GlcNAc Transferase p110 subunit Polyclonal specifically detects O-GlcNAc Transferase p110 subunit in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| O-GlcNAc Transferase p110 subunit | |
| Polyclonal | |
| Rabbit | |
| Amino Acids Drugs and other small molecules, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8473 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.4.1, EC 2.4.1.255 FLJ23071, HRNT1, MGC22921, O-GLCNAC, O-GlcNAc transferase p110 subunit, O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), O-linked N-acetylglucosamine transferase 110 kDa subunit, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit, uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase | |
| OGT | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title