missing translation for 'onlineSavingsMsg'
Learn More
Learn More
O-GlcNAcase/OGA/MGEA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | O-GlcNAcase/OGA/MGEA5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18224313
|
Novus Biologicals
NBP2-57562 |
100 μL |
€ 593.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18662497
|
Novus Biologicals
NBP2-57562-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
O-GlcNAcase/OGA/MGEA5 Polyclonal specifically detects O-GlcNAcase/OGA/MGEA5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| O-GlcNAcase/OGA/MGEA5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| bifunctional protein NCOAT, FLJ11229, HEXC, hyaluronidase in meningioma, KIAA0679, MEA5FLJ23355, meningioma expressed antigen 5 (hyaluronidase), Meningioma-expressed antigen 5, NCOAT, Nuclear cytoplasmic O-GlcNAcase and acetyltransferase, OGA, O-GlcNAcase | |
| OGA | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10724 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title