missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OA1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 214.00 - € 493.00
Specifications
| Antigen | OA1 |
|---|---|
| Dilution | Western Blot 1:1000-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18639841
|
Novus Biologicals
NBP2-94189-0.02ml |
0.02 mL |
€ 214.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635562
|
Novus Biologicals
NBP2-94189-0.1ml |
0.1 mL |
€ 493.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OA1 Polyclonal antibody specifically detects OA1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| OA1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.3), 50% glycerol | |
| 4935 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| G protein-coupled receptor 143, G-protein coupled receptor 143, NYS6, OA1Ocular albinism type 1 protein, ocular albinism 1 (Nettleship-Falls) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 314-404 of human GPR143 (NP_000264.2). TGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title