missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OATL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56840
This item is not returnable.
View return policy
Description
OATL1 Polyclonal specifically detects OATL1 in Human samples. It is validated for Western Blot.
Specifications
| OATL1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| MG81, MGC126866, MGC126868, MGC149732, OATL1MGC149731, ornithine aminotransferase-like 1, TBC1 domain family member 25, TBC1 domain family, member 25 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4943 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q3MII6 | |
| TBC1D25 | |
| Synthetic peptides corresponding to TBC1D25(TBC1 domain family, member 25) The peptide sequence was selected from the N terminal of TBC1D25. Peptide sequence KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 84%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur