missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OBP2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 590.10
Specifications
| Antigen | OBP2A |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18141979
|
Novus Biologicals
NBP2-47349 |
0.1 mL |
€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661686
|
Novus Biologicals
NBP2-47349-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OBP2A Polyclonal specifically detects OBP2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| OBP2A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 29991 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| hOBPIIa, OBP, OBP2C, OBPIIa, odorant binding protein 2A, odorant-binding protein 2a, Odorant-binding protein IIa, putative odorant-binding protein 2c | |
| OBP2A | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title