missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OCT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | OCT2 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18661809
|
Novus Biologicals
NBP2-68683-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615188
|
Novus Biologicals
NBP2-68683 |
100 μg |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OCT2 Polyclonal antibody specifically detects OCT2 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| OCT2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol | |
| 5452 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| homeobox protein, Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2, OCT2Oct-2, Octamer-binding protein 2, Octamer-binding transcription factor 2, OTF-2, OTF2POU domain class 2, transcription factor 2, POU class 2 homeobox 2, POU domain, class 2, transcription factor 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLSHPQPPKCLEPPSH | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title