missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OCTN1/SLC22A4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 207.00 - € 470.00
Specifications
| Antigen | OCTN1/SLC22A4 |
|---|---|
| Dilution | Western Blot 1:1000-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18676122
|
Novus Biologicals
NBP2-94155-0.02ml |
0.02 mL |
€ 207.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18600392
|
Novus Biologicals
NBP2-94155-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OCTN1/SLC22A4 Polyclonal antibody specifically detects OCTN1/SLC22A4 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| OCTN1/SLC22A4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2). LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:1000-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6583 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title