missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OLT-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 590.10
Specifications
| Antigen | OLT-2 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18403172
|
Novus Biologicals
NBP2-30759-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18190175
|
Novus Biologicals
NBP2-30759 |
0.1 mL |
€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
OLT-2 Polyclonal specifically detects OLT-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| OLT-2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| OSCAR-Like Transcript-2 Protein, T Cell-Interacting, Activating Receptor On Myeloid Cells, T Cell-Interacting, Activating Receptor On Myeloid Cells 1, TARM1, T-Cell-Interacting, Activating Receptor On Myeloid Cells Protein 1 | |
| TARM1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| B6A8C7 | |
| 441864 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LFVPIMFALLKAGTPSPIQLQSPAGKEIDFSLVDVTAGDAGNYSCMYYQTKSPFWASEPSDQLEILVTVPPGTTSSNYSLGN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto