missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OR2K2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-68965
This item is not returnable.
View return policy
Description
OR2K2 Polyclonal antibody specifically detects OR2K2 in Human samples. It is validated for Western Blot
Specifications
| OR2K2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 26248 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| HSHTPCRH06, HTPCRH06OR2AN1P, MGC133152, olfactory receptor 2K2, Olfactory receptor OR9-17, olfactory receptor, family 2, subfamily AN, member 1 pseudogene, olfactory receptor, family 2, subfamily AR, member 1 pseudogene, olfactory receptor, family 2, subfamily K, member 2, OR2AR1P | |
| Synthetic peptides corresponding to OR2K2 (olfactory receptor, family 2, subfamily K, member 2) The peptide sequence was selected form the C terminal of OR2K2. Peptide sequence TCGAHLTVVILYYGAALSMYLKPSSSNAQKIDKIISLLYGVLTPMLNPII. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction