missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ORC5L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 433.00 - € 572.00
Specifications
| Antigen | ORC5L |
|---|---|
| Dilution | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunocytochemistry |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18414521
|
Novus Biologicals
NBP1-82476-25ul |
25 μL |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18227855
|
Novus Biologicals
NBP1-82476 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ORC5L Polyclonal specifically detects ORC5L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ORC5L | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5001 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Immunocytochemistry | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ORC5Lorigin recognition complex, subunit 5-like (yeast), ORC5P, ORC5T, origin recognition complex subunit 5, origin recognition complex, subunit 5, origin recognition complex, subunit 5 (yeast homolog)-like, origin recognition complex, subunit 5 homolog (yeast), origin recognition complex, subunit 5-like | |
| ORC5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title