missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OSBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | OSBP1 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18170859
|
Novus Biologicals
NBP2-47342 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678765
|
Novus Biologicals
NBP2-47342-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
OSBP1 Polyclonal specifically detects OSBP1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| OSBP1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5007 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMECFKVQPVIGENGGDARQRGHEAEESRVMLWKRNPLPKNAE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| OSBP1oxysterol-binding protein 1, oxysterol binding protein | |
| OSBP | |
| IgG | |
| Affinity Purified |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts